PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 478aa    MW: 54762.2 Da    PI: 6.6742
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18449.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-18195241148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed ll+++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
       KHN18449.1 195 KGQWTSDEDRLLIQLVEQYGLRKWSHIAQALP-GRIGKQCRERWHNHL 241
                      799*****************************.*************97 PP

2Myb_DNA-binding58.12e-18249289345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd++l++a+++ G++ W+ Ia++++ gRt++++k++w+
       KHN18449.1 249 IWTEEEDKILIQAHAEIGNK-WAEIAKKLP-GRTENSIKNHWN 289
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.738190245IPR017930Myb domain
SuperFamilySSF466894.58E-32192288IPR009057Homeodomain-like
SMARTSM007177.4E-17194243IPR001005SANT/Myb domain
PfamPF002496.5E-17195241IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-27196247IPR009057Homeodomain-like
CDDcd001678.78E-16198241No hitNo description
SMARTSM007172.9E-17246294IPR001005SANT/Myb domain
PROSITE profilePS5129421.475246296IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-22248294IPR009057Homeodomain-like
PfamPF002497.6E-17250289IPR001005SANT/Myb domain
CDDcd001673.24E-14250292No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDNIETNLTE NYASESKPMH LQENYLKPSM EDQLPFGTPS TQGFLQDSHH IDHLQFHVNG  60
SSSSNPIFGV QTPNFDPFDH NVTCESAPPD FEAYECKLFA ESNGSGHAHL MDNFQYVGYS  120
LNLPRTNQLD LMVANQSYVP FNALETKPLN FVVPDEVSCI SPPNYYKRVG LNKNLRESPS  180
TRITFKARKK SNIVKGQWTS DEDRLLIQLV EQYGLRKWSH IAQALPGRIG KQCRERWHNH  240
LRPDIKKDIW TEEEDKILIQ AHAEIGNKWA EIAKKLPGRT ENSIKNHWNA TKRRQYSKRK  300
CRSKYPRGSL LQEYIKSLNL DKNPPIDYRK KSDKNANAKT NNNGKAAAQP QCADQFCPNG  360
QIVPRYDFNE VPDFSLDDNL FEEGCSIDSL LDDMQSASTV DHEKDFDGKI MQCAPTMDGK  420
QSHHQVGIQC VHVVDEHHHD HETEMVAHTM GNEVKKEFDL VEMMSHMNGS HYSTHSPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-451932952104C-Myb DNA-Binding Domain
1mse_C2e-451932952104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283290.0EU028329.1 Glycine max clone BAC gmw1-24M16 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601427.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L22e-96MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0R0FA970.0A0A0R0FA97_SOYBN; Uncharacterized protein
STRINGGLYMA17G09640.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-94myb domain protein 98